PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g080120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 311aa    MW: 35307.6 Da    PI: 6.5118
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g080120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.7e-082592922154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp+++++++L +++gL+ +q+ +WF N+R +
  Sopim08g080120.0.1 259 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 292
                         469*****************************87 PP

2ELK26.31.8e-09213234122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK +L++++++++ ++++E++
  Sopim08g080120.0.1 213 ELKIELKQGFRSRIEDVREEIL 234
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.7E-194387IPR005540KNOX1
PfamPF037904.5E-174586IPR005540KNOX1
SMARTSM012566.8E-25102157IPR005541KNOX2
PfamPF037913.1E-18106156IPR005541KNOX2
PROSITE profilePS512139.184213233IPR005539ELK domain
PROSITE profilePS5007111.677233296IPR001356Homeobox domain
SuperFamilySSF466894.28E-16235300IPR009057Homeodomain-like
SMARTSM003891.4E-10235300IPR001356Homeobox domain
CDDcd000861.62E-11236297No hitNo description
Gene3DG3DSA:1.10.10.607.4E-25240298IPR009057Homeodomain-like
PfamPF059201.1E-17253292IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQQEEGGLGL MGSSNTSGLG GGDISSMMIS SEDHHNRNLN HYNQLKSEIA THPLYEQLLS  60
AHVACLRVAT PIDQLPLIDA QLTQSHNLLR SYASSQQQQQ QHSLSHHERQ ELDNFLAQYL  120
LVLCSFKEQL QQHVRVHAVE AVMACREIEQ NLQLLTGATL GEGTGATMSD DEDELQMDFS  180
LDVSGGDAHD LMGMGFGLPT ESERSLMERV RQELKIELKQ GFRSRIEDVR EEILRKRRAG  240
KLPGDTTTVL KNWWQQHSKW PYPTEDDKAK LVEETGLQLK QINNWFINQR KRNWHSNSQS  300
VTSLKSKRKR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12236292864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1289309RKRNWHSNSQSVTSLKSKRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLEU764100.0U76410.1 Lycopersicon esculentum homeobox 2 protein (THox2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001298112.10.0homeobox 2 protein
SwissprotQ9FPQ81e-165KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLK4CP120.0K4CP12_SOLLC; Uncharacterized protein
STRINGSolyc08g080120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67732329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-148KNOTTED-like homeobox of Arabidopsis thaliana 7